FGF2 (FGF basic) Protein, Human

$319

Human fibroblast growth factor-2 (FGF-2) recombinant protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 154 amino acids and having a molecular mass of 17.2kDa. This FGF-2 protein is purified by proprietary chromatographic techniques.

Package: 0.1 mg
Download Datasheet: pdf file

SKU: AP0003 Category: Tag:
  • Species: Human
  • Host Species/Expression System: E.coli
  • Molecular Weight: 17.2 kDa
  • Purity: ≥ 95 % by SDS-PAGE analysis
  • Format: Lyophilize
  • Biological Activity: EC50 is < 0.5 ng/ml. EC50 was determined by a cell proliferation assay using BALB/c 3T3 cells.
  • Endotoxin: <1.0 EU/μg as determined by LAL method
  • Formulation: 25 mM Sodium buffer with NaCl, pH 7.0
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile ddH2O. Stock solutions should be apportioned into working aliquots and store at ≤ -20°C. Future dilutions should be made in appropriate buffered solution.
  • Storage Condition: Store the lyophilized protein at -20℃ to -80℃ for lone term. After reconstitution, the protein solution is stable at -20℃ for 3 month, at 2-8℃ for up to 1 week. Avoid repeated freeze/thaw cycles.
  • Amino Acid Sequence: AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESN NYNTYRSRKY TSWYVALKRTGQYKLGSKTG PGQKAILFLP MSAKS

Inquire Now