- Species: Human
- Host Species/Expression System: E.coli
- Molecular Weight: 21 kDa
- Purity: ≥ 95 % by SDS-PAGE analysis
- Format: Lyophilized
- Biological Activity: EC50 is < 1 ng/ml. EC50 was determined by a cell proliferation assay using TF-1 human erythroleukemic cell.
- Endotoxin: <1.0 EU/μg as determined by LAL method
- Formulation: Phosphate buffered saline pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile ddH2O. Stock solutions should be apportioned into working aliquots and store at ≤ -20℃. Future dilutions should be made in appropriate buffered solution.
- Storage Condition: Store the lyophilized protein at -20℃ to -80℃ for lone term. After reconstitution, the protein solution is stable at -20℃ for 3 month, at 2-8℃ for up to 1 week. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. Avoid repeated freeze/thaw cycles
- Amino Acid Sequence: PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
- Synonyms: Interleukin-16
Inquire Now